PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A05G2283
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 352aa    MW: 38851.6 Da    PI: 6.901
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A05G2283genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.63.4e-194188148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++lv+++k +G g+W++ ++  g++R++k+c++rw +yl
      Gh_A05G2283 41 KGPWTPEEDQKLVQYIKNHGHGSWRALPKLAGLNRCGKSCRLRWTNYL 88
                     79********************************************97 PP

2Myb_DNA-binding53.36.2e-1794139148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++++E++ +++++  lG++ W++Ia +++ gRt++++k++w+++l
      Gh_A05G2283  94 RGKFSQDEEQTILHLHSILGNK-WSAIATHLP-GRTDNEIKNFWNTHL 139
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.7E-263291IPR009057Homeodomain-like
PROSITE profilePS5129418.7183688IPR017930Myb domain
SuperFamilySSF466892.73E-3138135IPR009057Homeodomain-like
SMARTSM007171.7E-154090IPR001005SANT/Myb domain
PfamPF002498.4E-184188IPR001005SANT/Myb domain
CDDcd001671.83E-124388No hitNo description
PROSITE profilePS5129426.68889143IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.5E-2792144IPR009057Homeodomain-like
SMARTSM007173.7E-1693141IPR001005SANT/Myb domain
PfamPF002497.9E-1694139IPR001005SANT/Myb domain
CDDcd001675.21E-1296139No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MVVKEAKQAI NQFGKPNKEE IKDKKKIMGR SPCCDEDGLK KGPWTPEEDQ KLVQYIKNHG  60
HGSWRALPKL AGLNRCGKSC RLRWTNYLRP DIKRGKFSQD EEQTILHLHS ILGNKWSAIA  120
THLPGRTDNE IKNFWNTHLK KKLIQMGIDP MTHQPRTDIF SSLPHLMVLA SLRDLLENPL  180
QAEAAQLAKL QYLQFLLQSS TASMASNDNY GGATTIGAED MEGFNLLNST QFSVGNNETS  240
QLLHYQPQEQ VPFGLQTSLN NEKKTSSNSD EMGHCSNFIV SQGDNLIDHS VAASCPLQSS  300
RTSPPATAGA ADASVSNVPG DASSASSYNG GAASPYWSDL YFDDSLMQDI IS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-30391435108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5783831e-67JX578383.1 Gossypium hirsutum clone NBRI_GE10395 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012446706.10.0PREDICTED: transcription factor WER-like
TrEMBLA0A0D2QPG00.0A0A0D2QPG0_G
STRINGPOPTR_0005s17080.11e-133(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.11e-100myb domain protein 93